| Cat.No. | Name | Information |
|---|---|---|
| M2767 | Ifenprodil Tartrate | Ifenprodil is an atypical noncompetitive antagonist at the NMDA receptor, it interacts with high affinity at a homogeneous population of NMDA receptors in neonatal rat forebrain with IC50 of 0.3 μM. |
| M9566 | Glycine | Glycine is an inhibitory neurotransmitter in the CNS and also acts as a co-agonist along with glutamate. |
| M2884 | NMDA | NMDA（N-Methyl-D-aspartic acid）is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor. |
| M3003 | CB-839 | CB-839 is a potent, selective, and orally bioavailable glutaminase inhibitor with IC50 of 24 nM for recombinant human GAC. |
| M3125 | VU 0364770 | VU 0364770 is a positive allosteric modulator(PAM) of mGlu4 with EC50 of 1.1 μM, exhibits insignificant activity at 68 other receptors, including other mGlu subtypes. |
| M3124 | VU 0364439 | VU 0364439 is a mGlu4 positive allosteric modulator (PAM), with EC50 of 19.8 nM. |
| M3003 | CB-839 | CB-839 is a potent, selective, and orally bioavailable glutaminase inhibitor with IC50 of 24 nM for recombinant human GAC. |
| M2962 | Procyclidine hydrochloride | Procyclidine hydrochloride blocks the effects of certain chemicals in the brain, and thus is used to treat Parkinson's disease or extrapyramidal side-effects caused by other medicines. |
| M2867 | MPEP hydrochloride | MPEP hydrochloride is a selective mGlu5 receptor antagonist with IC50 of 36 nM, exhibits no appreciable activity at mGlu1b/2/3/4a/7b/8a/6 receptors. |
| M2766 | IEM 1754 dihydrobromide | IEM 1754 dihydrobroMide is a selective AMPA/kainate receptor blockers for GluR1 and GluR3 with IC50 of 6 μM. |
| M2584 | MDL-29951 | MDL-29951 is a novel glycine antagonist of NMDA receptor activation (Ki=0.14 mM, [3H]glycine binding) in vitro and in vivo with IC50 value of 0.14 mM ([3H]glycine binding). |
| M2581 | Ampalex | Ampalex is an ampakine and nootropic that acts as an AMPA receptor positive allosteric modulator as a treatment for Alzheimer's disease, schizophrenia and mild cognitive impairment (MCI). |
| M2576 | VU 0361737 | VU 0361737 is a selective positive allosteric modulator (PAM) for mGlu4 receptor with EC50 of 240 nM and 110 nM at human and rat receptors, respectively. |
| M2542 | CTEP | CTEP (RO4956371) is a novel, long-acting, orally bioavailable allosteric antagonist of mGlu5 receptor with IC50 of 2.2 nM, shows >1000-fold selectivity over other mGlu receptors. |
| M2253 | Felbamate | Felbamate(Felbatol) is an anticonvulsant compound used in epilepsy research. |
| M1926 | LY404039 | LY404039 is a potent agonist of recombinant human mGlu2, mGlu3 receptors with Ki of 149 nM, 92 nM respectively. |
| M1897 | AZD6765 | AZD6765 is an NMDA receptor antagonist. |
| M54474 | PDZ1 Domain inhibitor peptide | PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95). |
| M53076 | CALP1 | CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca2+-binding site. |
| M52786 | NT 13 | NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. |
| M52785 | Tat-NR2Baa | Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive. |
| M52784 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. |
| M52783 | L-Homocysteic acid | L-Homocysteic acid (L-HCA) is an endogenous excitatory amino acid that acts as a NMDA receptor agonist (EC50: 14 μM). |
| M52782 | Leptin (116-130) | Leptin (116-130) is a bioactive leptin fragment. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2023 AbMole BioScience. All Rights Reserved.
