| Cat.No. | Name | Information |
|---|---|---|
| M2767 | Ifenprodil Tartrate | Ifenprodil is an atypical noncompetitive antagonist at the NMDA receptor, it interacts with high affinity at a homogeneous population of NMDA receptors in neonatal rat forebrain with IC50 of 0.3 μM. |
| M9566 | Glycine | Glycine is an inhibitory neurotransmitter in the CNS and also acts as a co-agonist along with glutamate. |
| M2884 | NMDA | NMDA（N-Methyl-D-aspartic acid）is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor. |
| M3003 | CB-839 | Telaglenastat (CB-839) is a potent, selective, and orally bioavailable glutaminase inhibitor with IC50 of 24 nM for recombinant human GAC. |
| M55228 | LY367385 hydrochloride | LY367385 hydrochloride is a highly selective and potent mGluR1a antagonist, with an IC50 of 8.8 μM for inhibiting of quisqualate-induced phosphoinositide (PI) hydrolysis, compared with >100 μM for mGlu5a. |
| M54474 | PDZ1 Domain inhibitor peptide | PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95). |
| M52786 | NT 13 | NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. |
| M52785 | Tat-NR2Baa | Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive. |
| M52784 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. |
| M52783 | L-Homocysteic acid | L-Homocysteic acid (L-HCA) is an endogenous excitatory amino acid that acts as a NMDA receptor agonist (EC50: 14 μM). |
| M52782 | Leptin (116-130) | Leptin (116-130) is a bioactive leptin fragment. |
| M52781 | Conantokin G | Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. |
| M52780 | Conantokin-T | Conantokin-T is a γ-carboxyglutamate-containing, N-methyl-D-aspartate (NMDA) antagonist peptidewith an IC50 value of 2 μM. |
| M52779 | p-fin4 | p-fin4 is a peptide inhibitor of STEP Phosphatase-GluA2 AMPA receptor interaction with a Ki of 0.4 μM. |
| M52409 | L-Cysteine S-sulfate | L-Cysteine S-sulfate is a potent N-methyl-d-aspartate (NMDA) glutamatergic receptor agonist. |
| M49730 | NMDAR/TRPM4-IN-2 | NMDAR/TRPM4-IN-2 is a potent NMDAR/TRPM4 interaction interface inhibitor. |
| M49641 | CHPG sodium salt | CHPG sodium salt is a selective mGluR5 agonist, and attenuates SO2-induced oxidative stress and inflammation through TSG-6/NF-κB pathway in BV2 microglial cells. |
| M45026 | Trans sodium crocetinate | Crocetin (Transcrocetin) disodium, extracted from saffron (Crocus sativus L.), acts as an NMDA receptor antagonist with high affinity. |
| M44821 | Crocetin meglumine | Crocetin (Transcrocetin) meglumine, extracted from saffron (Crocus sativus L.), acts as an NMDA receptor antagonist with high affinity. |
| M42207 | MPX-004 | MPX-004 is a potent GluN2A antagonist. |
| M42206 | GluN2B-NMDAR antagonist-1 | GluN2B-NMDAR antagonist-1 is an orally active GluN2B-NMDAR antagonist. |
| M42205 | Risevistinel | Risevistinel (NYX-783) is a positive allosteric modulator of N-methyl-D-aspartate (NMDA) receptor. |
| M42204 | NMDA receptor antagonist 6 | NMDA receptor antagonist 6 is an antagonist of NMDA receptor, targeting to the glycine binding site. |
| M42203 | CP-465022 | CP-465022 is a potent, and selective noncompetitive AMPA receptor antagonist with anticonvulsant activity. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.
