Free shipping on all orders over $ 500

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Cat. No. M52784

All AbMole products are for research use only, cannot be used for human consumption.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW Structure

Price and Availability

For this product's availability, delivery time and price, please email [email protected] directly or click the "Inquiry Now" button below.


Quality Control & Documentation
Biological Activity

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.

Chemical Information
Molecular Weight 3490.06
Formula C171H250N40O39
CAS Number 2279952-25-7
Storage Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Related GluR Products
Naftazone

Naftazone protects blood vessels, increases venous tonicity and capillary resistance, and improves lymphatic and venous circulation. Naftazone can be used for the research of venous insufciency.

VU0650786

VU0650786 is a potent and selective CNS penetrant negative allosteric modulator of metabotropic glutamate receptor subtype 3 (mGlu3 NAM), with an IC50 of 392 nM.

NS-102

NS-102 is a selective kainate (GluK2) receptor antagonist.

VU0424465 

VU0424465 is a potent and partial PAM (positive allosteric modulator)-agonist for mGlu5 mediated iCa2+ mobilization.

ATPA 

ATPA is a selective glutamate receptor GluR5 activator with EC50s of 0.66, 9.5, 1.4, 23, 32, 18, and 14 μM for GluR5wt, GluR5(S741M), GluR5(S721T), GluR5(S721T, S741M), GluR5(S741A), GluR5(S741L), and GluR5(S741V), respectively.

  Catalog
Abmole Inhibitor Catalog




Keywords: VSGLNPSLWSIFGLQFILLWLVSGSRHYLW supplier, GluR, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.