All AbMole products are for research use only, cannot be used for human consumption.
For this product's availability, delivery time and price, please email [email protected] directly or click the "Inquiry Now" button below.
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.
Molecular Weight | 4157.17 |
Formula | C191H336N62O39S |
CAS Number | 154338-08-6 |
Storage |
Powder -20°C 3 years ; 4°C 2 years In solvent -80°C 6 months ; -20°C 1 month |
Related Antibiotic Products |
---|
N-Hydroxypipecolic acid
N-Hydroxypipecolic acid (1-Hydroxy-2-piperidinecarboxylic acid), a plant metabolite and a systemic acquired resistance (SAR) regulator, orchestrates SAR establishment in concert with the immune signal salicylic acid. N-Hydroxypipecolic acid accumulates systemically in the plant foliage in response to pathogen attack. N-Hydroxypipecolic acid induces SAR to bacterial and oomycete infection. |
Rosoxacin
Rosoxacin (Acrosoxacin) is an orally active and broad-spectrum antibacterial quinolone antibiotic. Rosoxacin inhibits Gram-negative bacteria, including N. gonorrhoeae (MIC range=0.03-0.125 µg/mL). |
2-Nitrosopyridine
2-Nitrosopyridine is a nitroso compound that can be used to synthesize antibiotics. 2-Nitrosopyridine can be used as a Click or Diels-Alder derivatization reagent and an excellent dienophile. |
Cethromycin
Cethromycin (ABT-773) is a ketolide antibiotic. |
Nacubactam
Nacubactam (OP0595 free acid) is a potent non-β-lactam-β-lactamase inhibitor with activity against class A and class C β-lactamases. |
All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.