Free shipping on all orders over $ 500

PMAP-36

Cat. No. M53560

All AbMole products are for research use only, cannot be used for human consumption.

PMAP-36 Structure

Price and Availability

For this product's availability, delivery time and price, please email [email protected] directly or click the "Inquiry Now" button below.


Quality Control & Documentation
Biological Activity

PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.

Chemical Information
Molecular Weight 4157.17
Formula C191H336N62O39S
CAS Number 154338-08-6
Storage Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Related Antibiotic Products
Puromycin-d3

Puromycin-d3 is the deuterium labeled Puromycin. Puromycin dihydrochloride is the dihydrochloride salt of puromycin. Puromycin is an aminoglycoside antibiotic that inhibits protein synthesis.

BSH-IN-1

BSH-IN-1 is a potent and covalent inhibitor of gut bacterial recombinant bile salt hydrolases (BSHs) with IC50s of 108 nM and 427 nM for B. longum BSH (Gram positive) and B. theta BSH (Gram negative), respectively.

AAA-10

AAA-10 is an orally active gut bacterial bile salt hydrolases (BSH) inhibitor, with IC50s of 10 nM, 80 nM against B. theta rBSH and B. longum rBSH respectively.

Gut restricted-7

Gut restricted-7 (GR-7) is a potent, covalent and orally active pan-bile salt hydrolase (BSH) inhibitor. Gut restricted-7 has a tissue-selective and is restricted to the gut. Gut restricted-7 decreases gut bacterial BSHs and decreases deconjugated bile acid levels in feces of mice.

N-Hydroxypipecolic acid

N-Hydroxypipecolic acid (1-Hydroxy-2-piperidinecarboxylic acid), a plant metabolite and a systemic acquired resistance (SAR) regulator, orchestrates SAR establishment in concert with the immune signal salicylic acid. N-Hydroxypipecolic acid accumulates systemically in the plant foliage in response to pathogen attack. N-Hydroxypipecolic acid induces SAR to bacterial and oomycete infection.

  Catalog
Abmole Inhibitor Catalog




Keywords: PMAP-36 supplier, Antibiotic, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.