Free shipping on all orders over $ 500

 About 1 result found for searched term "154338-08-6" (0.213 seconds)

Cat.No.  Name Target
M53560 PMAP-36 Antibiotic
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.