Free shipping on all orders over $ 500

 About 1 result found for searched term "PMAP-36" (0.092 seconds)

Cat.No.  Name Target
M53560 PMAP-36 Antibiotic
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.


 
Get to Know Us
Customer Support
Resources
Contact Us

Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.