Certificate of Analysis

 

Product Name: PMAP-36
Catalog Number: M53560
CAS Number: 154338-08-6

Physical and Chemical Properties
Formula: C191H336N62O39S
Molecular Weight: 4157.17
Storage: Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Chemical Structure: PMAP-36 Structure
Analytical Data
QC Standard:
H-NMR: Consistent with structure
Product Information
Description: PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.
   
Stability and Solubility Advice: Information concerning product stability, particularly in solution, has rarely been reported and in most cases we can only offer a general guide.
We recommend that stock solutions, once prepared, are stored aliquoted in tightly sealed vials and used within 1 month. Avoid repeated freeze and thaw cycles. Storage conditions for some special products should refer to their storage details.