Product Name: | PMAP-36 |
Catalog Number: | M53560 |
CAS Number: | 154338-08-6 |
Formula: | C191H336N62O39S |
Molecular Weight: | 4157.17 |
Storage: |
Powder -20°C 3 years ; 4°C 2 years In solvent -80°C 6 months ; -20°C 1 month |
Chemical Structure: | ![]() |
QC Standard: | |
H-NMR: | Consistent with structure |
Description: | PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. |
Stability and Solubility Advice: | Information concerning product stability, particularly in solution, has rarely been reported and in most cases we can only offer a general guide. We recommend that stock solutions, once prepared, are stored aliquoted in tightly sealed vials and used within 1 month. Avoid repeated freeze and thaw cycles. Storage conditions for some special products should refer to their storage details. |