| Cat.No. | Name | Information |
|---|---|---|
| M3669 | Micafungin Sodium | Micafungin Sodium is an inhibitor of 1, 3-beta-D-glucan synthesis, it is an antifungal agent. |
| M5868 | Penicillin G Sodium | Penicillin G Sodium is a β-lactam antibiotic produced by Penicillin spp. |
| M4947 | Streptomycin sulfate | Streptomycin sulfate is an antibiotic produced by the soil actinomycete Streptomyces griseus. It acts by inhibiting the initiation and elongation processes during protein synthesis. |
| M4323 | Physcion | Physcion is an anthraquinone from roots of Rheum officinale Baill. |
| M2719 | G-418 disulfate | G-418 disulfate (Geneticin) blocks polypeptide synthesis by inhibiting the elongation step in both prokaryotic and eukaryotic cells. |
| M5415 | Amphotericin B | Amphotericin B (AmB) is an amphipathic polyene antibiotic which permeabilizes ergosterol-containing membranes. |
| M3594 | Neomycin sulfate | Neomycin sulfate belongs to a class of antibiotics known as the aminoglycosides. |
| M2391 | Ampicillin Trihydrate | Ampicillin Trihydrate is a β-lactam antibiotic, which inhibits bacterial cell-wall synthesis (peptidoglycan cross-linking) by inactivating transpeptidases on the inner surface of the bacterial cell membrane. |
| M4862 | Vancomycin HCl | Vancomycin HCl is a hydrochloride of vancomycin that is a narrow-spectrum glycopeptide antibacterial agent. |
| M2652 | Doxycycline monohydrate | Doxycycline monohydrate is a tetracycline antibiotic that commonly used to treat a variety of infections and MMP inhibitor. |
| M53560 | PMAP-36 | PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. |
| M53559 | Tet-213 | Tet-213 is a antimicrobial peptide. |
| M53558 | D-K6L9 | D-K6L9 shows antimicrobial and antibiofilm activities against P. |
| M53557 | EcAMP3 | EcAMP3 is a hairpin-like peptide. |
| M53556 | GLK-19 | GLK-19 is an antimicrobial peptide, and is active against E. |
| M53555 | L-K6L9 | L-K6L9 shows antimicrobial and antibiofilm activities against P. |
| M53554 | LS-BF1 | LS-BF1 is a stable and low toxic cationic antimicrobial peptide. |
| M53553 | Mram 8 | Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family. |
| M53551 | DJK-5 | Diplacol ia a natural compound from from Mimulus clevelandi and shows potent inhibitory activities against lipopolysaccharide (LPS)-induced nitric oxide production. |
| M53550 | CaLL | CaLL is an antimicrobial peptide. |
| M53548 | PGLa | PGLa, a 21-residue peptide, is an antimicrobial peptide. |
| M53547 | PP13 | PP13 is an antimicrobial peptide, and is active against Gram-negative and Gram-positive bacteria E.coli (MIC: 16.7 uM), B. |
| M53546 | RP-1 | RP-1 is an antimicrobial peptide, and is active against S. |
| M53545 | XT-1 | XT-1 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. |
| M53544 | XT-4 | XT-4 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. |
| M53543 | K11 | K11 is an antimicrobial peptide. |
| M53542 | MCF | MCF is an antimicrobial peptide derived from bee venom. |
| M53540 | P1 | P1 is a broad-spectrum antimicrobial peptide. |
| M49846 | Antitubercular agent-41 | Antitubercular agent-41 is an antitubercular agent that can be used in the study of Mycobacterium tuberculosis infection. |
| M49498 | Golotimod hydrochloride | Golotimod hydrochloride (SCV 07 hydrochloride), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.
