| Cat.No. | Name | Information |
|---|---|---|
| M3669 | Micafungin Sodium | Micafungin Sodium is an inhibitor of 1, 3-beta-D-glucan synthesis, it is an antifungal agent. |
| M5868 | Penicillin G Sodium | Penicillin G Sodium is a β-lactam antibiotic produced by Penicillin spp. |
| M4947 | Streptomycin sulfate | Streptomycin sulfate is an antibiotic produced by the soil actinomycete Streptomyces griseus. It acts by inhibiting the initiation and elongation processes during protein synthesis. |
| M4323 | Physcion | Physcion is an anthraquinone from roots of Rheum officinale Baill. |
| M2719 | G-418 disulfate | G-418 disulfate (Geneticin) blocks polypeptide synthesis by inhibiting the elongation step in both prokaryotic and eukaryotic cells. |
| M5415 | Amphotericin B | Amphotericin B (AmB) is an amphipathic polyene antibiotic which permeabilizes ergosterol-containing membranes. |
| M3594 | Neomycin sulfate | Neomycin sulfate belongs to a class of antibiotics known as the aminoglycosides. |
| M2391 | Ampicillin Trihydrate | Ampicillin Trihydrate is a β-lactam antibiotic, which inhibits bacterial cell-wall synthesis (peptidoglycan cross-linking) by inactivating transpeptidases on the inner surface of the bacterial cell membrane. |
| M4862 | Vancomycin HCl | Vancomycin HCl is a hydrochloride of vancomycin that is a narrow-spectrum glycopeptide antibacterial agent. |
| M2652 | Doxycycline monohydrate | Doxycycline monohydrate is a tetracycline antibiotic that commonly used to treat a variety of infections and MMP inhibitor. |
| M53574 | Maximin 2 | Maximin 2 is an antimicrobial peptide derived from skin secretions of Bombina maxima. |
| M53573 | Maximin 3 | Maximin 3 is an antimicrobial peptide derived from skin secretions of Bombina maxima. |
| M53572 | Maximin 4 | Maximin 4 is an antimicrobial peptide derived from skin secretions of Bombina maxima. |
| M53571 | Maximin 5 | Maximin 5 is an antimicrobial peptide derived from skin secretions of Bombina maxima. |
| M53570 | Maximin 8 | Maximin 8 is a antimicrobial peptide that can be found in B. |
| M53569 | Parasin I | Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity. |
| M53568 | Ranalexin | Ranalexin is an antimicrobial peptide. |
| M53567 | GE 2270A | GE 2270A (MDL 62879) is an antibiotic. |
| M53566 | Abaecin | Abaecin is an antibacterial response peptide. |
| M53565 | AMPR-22 | AMPR-22 is an antimicrobial peptide. |
| M53564 | Arg-Trp | Arg-Trp is a dipeptide composed of arginine and tryptophan, and analogues of Arg-Trp-octyl ester show antibacterial activity. |
| M53563 | DFTamP1 | DFTamP1 is an antimicrobial peptide against Staphylococcus aureus USA300 activity (MIC is 3.1 μM). |
| M53562 | IN-2-LF | IN-2-LF is an inhibitor of lethal factor. |
| M53561 | KAMP-19 | KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. |
| M53560 | PMAP-36 | PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. |
| M53559 | Tet-213 | Tet-213 is a antimicrobial peptide. |
| M53558 | D-K6L9 | D-K6L9 shows antimicrobial and antibiofilm activities against P. |
| M53557 | EcAMP3 | EcAMP3 is a hairpin-like peptide. |
| M53556 | GLK-19 | GLK-19 is an antimicrobial peptide, and is active against E. |
| M53555 | L-K6L9 | L-K6L9 shows antimicrobial and antibiofilm activities against P. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.
