All AbMole products are for research use only, cannot be used for human consumption.
Pepinh-TRIF TFA blocks TIR-domain-containing adapter-inducing interferon-β (TRIF) signaling by interfering with TLR-TRIF interaction.
Sequence: RQIKIWFQNRRMKWKKFCEEFQVPGRGELH-NH2
Molecular Weight | 4016.63 |
Formula | C180H279F3N58O40S2 |
Solubility (25°C) | Water 40 mg/mL |
Storage | Powder -20°C, protect from light, dry, sealed |
Related TLR Products |
---|
CZ-48
CZ-48 (Sulfo-ara-F-NMN) is a mimetic of nicotinamide mononucleotide (NMN). CZ-48 acts selectively, activating SARM1 but inhibiting CD38 (IC50 around 10 μM). CZ-48 induces intracellular cyclic ADP-ribose (cADPR) production. |
5-Iodoisoquinoline
5-Iodoisoquinoline is a potent and selective SARM1 NADase inhibitor with an IC50 of 75 nM. 5-Iodoisoquinoline is selective against other NAD+-processing enzymes, receptors, and transporters. |
CAY10614
CAY10614 is a potent TLR4 antagonist. CAY10614 inhibits the lipid A-induced activation of TLR4, with an IC50 of 1.675 μM. |
TLR4-IN-C34-C2-COOH
TLR4-IN-C34-C2-COO is a linker that incorporates TLR4 inhibitor TLR4-IN-C34. TLR4-IN-C34 inhibits TLR4 in enterocytes and macrophages, and reduces systemic inflammation in mouse models of endotoxemia and necrotizing enterocolitis. |
BNT411
BNT411 is a selective TLR7 agonist that can induce the release of IFNa both in vivo and in vitro. |
All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.