Free shipping on all orders over $ 500

7-Chlorokynurenic acid sodium salt

Cat. No. M6355
7-Chlorokynurenic acid sodium salt Structure
Size Price Availability
10mg USD 75  USD75 1-2 Weeks
50mg USD 300  USD300 1-2 Weeks
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
Biological Activity

7-Chlorokynurenic acid sodium salt is a sodium salt of 7-Chlorokynurenic acid, an NMDA receptor antagonist acting at the glycine site. Potent competitive inhibitor of L-glutamate transport into synaptic vesicles.

Chemical Information
Molecular Weight 245.59
Formula C10H5ClNNaO3
CAS Number 1263094-00-3
Form Solid
Solubility (25°C) Water 24.56 mg/mL
Storage Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Conversion of different model animals based on BSA (PMID: 27057123)
Species Mouse Rat Rabbit Guinea pig Hamster Dog
Weight (kg) 0.02 0.15 1.8 0.4 0.08 10
Body Surface Area (m2) 0.007 0.025 0.15 0.05 0.02 0.5
Km factor 3 6 12 8 5 20
Animal A (mg/kg) = Animal B (mg/kg) multiplied by  Animal B Km
Animal A Km

For example, to modify the dose of Compound A used for a mouse (20 mg/kg) to a dose based on the BSA for a rat, multiply 20 mg/kg by the Km factor for a mouse and then divide by the Km factor for a rat. This calculation results in a rat equivalent dose for Compound A of 10 mg/kg.

References

[1] R A Wallis, et al. Glycine-induced CA1 excitotoxicity in the rat hippocampal slice

[2] R A Wallis, et al. Glycine-induced CA1 excitotoxicity in the rat hippocampal slice

[3] J J Woodward, et al. Potentiation of N-methyl-D-aspartate-stimulated dopamine release from rat brain slices by aluminum fluoride and carbachol

Related GluR Products
PDZ1 Domain inhibitor peptide

PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95).

CALP1

CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca2+-binding site.

NT 13

NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide.

Tat-NR2Baa

Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.

  Catalog
Abmole Inhibitor Catalog




Keywords: 7-Chlorokynurenic acid sodium salt supplier, GluR, inhibitors, activators


Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2023 AbMole BioScience. All Rights Reserved.