Free shipping on all orders over $ 500

 About 8 results found for searched term "LW3" (0.441 seconds)

Cat.No.  Name Target
M45166 LWY713 PROTAC
LWY713 is a PROTAC molecule targeting FLT3 with acetyl group as linker, which can selectively induce FLT3 degradation in CRBN and proteasome-dependent manner, with a DC50 of 0.64 nM and a Dmax of 94.8%, and possesses antitumor activity.
M7896 LWH-63 hydrochloride Others
Non-peptide CRF1 corticotrophin-releasing factor antagonist.
M29819 ZLWH-23  AChR/AChE
ZLWH-23 is a selective AChE inhibitor (IC50=0.27 μM) with GSK-3β inhibitory property (IC50=6.78 μM). ZLWH-23 possesses selectivity for AChE over BChE (IC50=20.82 μM) and for GSK-3β over multi-kinases. ZLWH-23 has the potential for the research of Alzheimer's disease.
M41159 LW3 Antifungal
LW3 is a potent antifungal agent.
M18358 Demethylwedelolactone Others
Demethylwedelolactone is a potent trypsin inhibitor with an IC50 of 3.0 μM. Demethylwedelolactone suppresses cell motility and cell invasion of breast cancer cell.
M39902 Demethylwedelolactone Sulfate Others
Demethylwedelolactone Sulfate (Demethylwedelolactone 3-sulfate) is a coumestan isolated from Eclipta prostrata L..
M43227 YLLEMLWRL Others
YLLEMLWRL is an HLA-A2-restricted T cell epitope sequence corresponding to codon 125-133.
M52784 VSGLNPSLWSIFGLQFILLWLVSGSRHYLW GluR
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.