About 8 results found for searched term "LW3" (0.441 seconds)
Cat.No. | Name | Target |
---|---|---|
M45166 | LWY713 | PROTAC |
LWY713 is a PROTAC molecule targeting FLT3 with acetyl group as linker, which can selectively induce FLT3 degradation in CRBN and proteasome-dependent manner, with a DC50 of 0.64 nM and a Dmax of 94.8%, and possesses antitumor activity. | ||
M7896 | LWH-63 hydrochloride | Others |
Non-peptide CRF1 corticotrophin-releasing factor antagonist. | ||
M29819 | ZLWH-23 | AChR/AChE |
ZLWH-23 is a selective AChE inhibitor (IC50=0.27 μM) with GSK-3β inhibitory property (IC50=6.78 μM). ZLWH-23 possesses selectivity for AChE over BChE (IC50=20.82 μM) and for GSK-3β over multi-kinases. ZLWH-23 has the potential for the research of Alzheimer's disease. | ||
M41159 | LW3 | Antifungal |
LW3 is a potent antifungal agent. | ||
M18358 | Demethylwedelolactone | Others |
Demethylwedelolactone is a potent trypsin inhibitor with an IC50 of 3.0 μM. Demethylwedelolactone suppresses cell motility and cell invasion of breast cancer cell. | ||
M39902 | Demethylwedelolactone Sulfate | Others |
Demethylwedelolactone Sulfate (Demethylwedelolactone 3-sulfate) is a coumestan isolated from Eclipta prostrata L.. | ||
M43227 | YLLEMLWRL | Others |
YLLEMLWRL is an HLA-A2-restricted T cell epitope sequence corresponding to codon 125-133. | ||
M52784 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | GluR |
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.