About 2 results found for searched term "FGL peptide" (0.12 seconds)
| Cat.No. | Name | Target |
|---|---|---|
| M51668 | FGL peptide | Others |
| FGL peptide, is a polypeptide that can be found by peptide screening. | ||
| M52784 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | GluR |
| VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. | ||
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.
