About 2 results found for searched term "FGL peptide" (0.208 seconds)
Cat.No. | Name | Target |
---|---|---|
M51668 | FGL peptide | Others |
FGL peptide, is a polypeptide that can be found by peptide screening. | ||
M52784 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | GluR |
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.