Free shipping on all orders over $ 500

Recombinant Mouse Midkine (E. coli, C-His)

Cat. No. M10286

All AbMole products are for research use only, cannot be used for human consumption.

Recombinant Mouse Midkine (E. coli, C-His) Structure
Synonym:

MK; MDK; rm-midkine

Size Price Availability Quantity
5ug USD 130  USD130 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
  • Purity: >98%, Endotoxin < 0.1 EU/μg
  • COA
  • MSDS
Biological Activity

Midkine (MDK) is a heparin-binding growth factor, which contains 121 amino acid residues with 5 disulfide bonds. It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration. Midkine promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis.

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-100 ng/ml.

MKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGAD
CKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD with polyhistidine tag at the C-terminus.


Accession: P12025

Endotoxin < 0.1 EU/µg

Apparent Molecular Weight: 17 KDa, reducing conditions

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Chemical Information
Form Lyophilized powder
Solubility (25°C) Reconstitute the lyophilized powder in distilled water up to 100 μg/ml.
Storage Stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days and at -20°C for 3 months.
References

[1] Ludwig T Weckbach, et al. Blood. The cytokine midkine supports neutrophil trafficking during acute inflammation by promoting adhesion via β2 integrins (CD11/CD18)

[2] S Kojima, et al. J Biol Chem. Midkine enhances fibrinolytic activity of bovine endothelial cells

Related Cytokines and Growth Factors Products
Recombinant Human GDF-15 Protein (HEK293 N-hFc)

Growth-differentiation factor 15 (GDF15), also known as MIC-1, is a secreted member of the transforming growth factor (TGF)-β superfamily. GDF-15 has a role in regulating inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF-15 overexpression arising from an expanded erythroid compartment contributes to iron overload in thalassemia syndromes by inhibiting hepcidin expression.

Recombinant Human FGFR1 Protein (HEK293, C-His)

FGFR1, also known as CD331, is a full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain.

Recombinant Human FGFR2 Protein (HEK293, C-His)

FGFR2, also known as CD332, acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation, migration and apoptosis, and in the regulation of embryonic development. FGFR2 plays an essential role in the regulation of osteoblast differentiation, proliferation and apoptosis, and is required for normal skeleton development. It also promotes cell proliferation in keratinocytes and imature osteoblasts, but promotes apoptosis in differentiated osteoblasts.

Recombinant Mouse BMP-4 Protein (E. coli, C-His)

Bone Morphogenetic Protein-4 (BMP-4) is a critical signaling molecule required for the early differentiation of the embryo and establishing of a dorsal-ventral axis. BMP-4 is secreted from the dorsal portion of the notochord, and it acts in concert with sonic hedgehog to establish a dorsal-ventral axis for the differentiation of later structures.

Recombinant Human Coagulation Factor X (HEK293, C-Fc)

Coagulation factor X, belongs to the peptidase S1 family. Coagulation factor X is initially synthesized in the liver. Coagulation factor X is a vitamin K-dependent glycoprotein that converts prothrombin to thrombin in the presence of factor Va, calcium and phospholipid during blood clotting.

  Catalog
Abmole Inhibitor Catalog




Keywords: Recombinant Mouse Midkine (E. coli, C-His), MK; MDK; rm-midkine supplier, Cytokines and Growth Factors, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.