All AbMole products are for research use only, cannot be used for human consumption.
Midkine (MDK) is a heparin-binding growth factor, which contains 121 amino acid residues with 5 disulfide bonds. It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration. Midkine promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis.
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-100 ng/ml.
MKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGAD
CKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD with polyhistidine tag at the C-terminus.
Accession: P12025
Endotoxin < 0.1 EU/µg
Apparent Molecular Weight: 17 KDa, reducing conditions
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Form | Lyophilized powder |
Solubility (25°C) | Reconstitute the lyophilized powder in distilled water up to 100 μg/ml. |
Storage | Stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days and at -20°C for 3 months. |
[2] S Kojima, et al. J Biol Chem. Midkine enhances fibrinolytic activity of bovine endothelial cells
Related Cytokines and Growth Factors Products |
---|
Recombinant Human FGF-8b Protein (E. coli)
Recombinant Human FGF-8b Protein is a heparin-binding growth factor, which plays a core role in prenatal development, postnatal growth and regeneration of various tissues by promoting cell proliferation and other effect. |
Recombinant Rat GDNF Protein (Baculovirus-Insect, N-His)
GDNF is an important member of the GDNF family of ligands. GDNF plays a key role in the promotion of the survival of dopaminergic neurons. GDNF is a highly conserved neurotrophic factor. The recombinant form of this protein also promotes the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. GDNF also regulates kidney development and spermatogenesis, and it affects alcohol consumption. |
Recombinant Rat PDGF-BB (E. coli)
Platelet-Derived Growth Factor-BB (PDGF-BB) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. PDGF-BB functions in a paracrine manner and promotes organogenesis, human skeletal development, and wound healing. PDGF-BB also promotes angiogenesis, particularly in the presence of Fibroblast Growth Factor basic. |
Recombinant Human ApoE3 Protein (HEK293, C-6His)
ApoE is a constituent of a subclass of high density of lipoproteins (HDL) involved in cholesterol transport. ApoE mediates high affinity binding of chylomicrons and vLDL particles to the LDL receptor, allowing for specific uptake of these particles by the liver, preventing the accumulation of cholesterol rich particles in the plasma. |
Recombinant Mouse Granzyme B (HEK293, C-6His)
Granzyme B (GZMB) is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp and seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. The protein cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis. |
All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.