Free shipping on all orders over $ 500

Recombinant Human BMP-9 Protein (E. coli, His Tag)

Cat. No. M55353

All AbMole products are for research use only, cannot be used for human consumption.

Recombinant Human BMP-9 Protein (E. coli, His Tag) Structure
Synonym:

Bone Morphogenetic Protein-9; GDF-2

Size Price Availability Quantity
5ug USD 140  USD140 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
  • Purity: >98%, Endotoxin < 0.01 EU/µg
  • COA
  • MSDS
Biological Activity

Bone Morphogenetic Protein-9 (BMP-9), also known as Growth differentiation factor 2 (GDF2), is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-9/GDF-2 selectively signals through ACVRL1 in endothelial cells. Additionally, it engages in high-affinity interactions with ENG, forming a heterotetramer or a heteromeric complex with ENG and ACVRL1.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells, the ED50 for this effect is <0.4 ng/mL.

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGG
CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPI
SVLYKDDMGVPTLKYHYEGMSVAECGCR with polyhistidine tag at the N-terminus.


Accession: Q9UK05

Endotoxin < 0.01 EU/µg

Apparent Molecular Weight: ~16 KDa, reducing conditions

Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Chemical Information
Form Lyophilized powder
Solubility (25°C) Reconstitute the lyophilized powder in distilled water up to 100 μg/ml.
Storage Stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days and at -20°C for 3 months.
Related Cytokines and Growth Factors Products
Recombinant Human GDF-15 Protein (HEK293 N-hFc)

Growth-differentiation factor 15 (GDF15), also known as MIC-1, is a secreted member of the transforming growth factor (TGF)-β superfamily. GDF-15 has a role in regulating inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF-15 overexpression arising from an expanded erythroid compartment contributes to iron overload in thalassemia syndromes by inhibiting hepcidin expression.

Recombinant Human FGFR1 Protein (HEK293, C-His)

FGFR1, also known as CD331, is a full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain.

Recombinant Human FGFR2 Protein (HEK293, C-His)

FGFR2, also known as CD332, acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation, migration and apoptosis, and in the regulation of embryonic development. FGFR2 plays an essential role in the regulation of osteoblast differentiation, proliferation and apoptosis, and is required for normal skeleton development. It also promotes cell proliferation in keratinocytes and imature osteoblasts, but promotes apoptosis in differentiated osteoblasts.

Recombinant Mouse BMP-4 Protein (E. coli, C-His)

Bone Morphogenetic Protein-4 (BMP-4) is a critical signaling molecule required for the early differentiation of the embryo and establishing of a dorsal-ventral axis. BMP-4 is secreted from the dorsal portion of the notochord, and it acts in concert with sonic hedgehog to establish a dorsal-ventral axis for the differentiation of later structures.

Recombinant Human Coagulation Factor X (HEK293, C-Fc)

Coagulation factor X, belongs to the peptidase S1 family. Coagulation factor X is initially synthesized in the liver. Coagulation factor X is a vitamin K-dependent glycoprotein that converts prothrombin to thrombin in the presence of factor Va, calcium and phospholipid during blood clotting.

  Catalog
Abmole Inhibitor Catalog




Keywords: Recombinant Human BMP-9 Protein (E. coli, His Tag), Bone Morphogenetic Protein-9; GDF-2 supplier, Cytokines and Growth Factors, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.