Free shipping on all orders over $ 500

Recombinant Human BMP-9 Protein (E. coli, His Tag)

Cat. No. M55353

All AbMole products are for research use only, cannot be used for human consumption.

Recombinant Human BMP-9 Protein (E. coli, His Tag) Structure
Synonym:

Bone Morphogenetic Protein-9; GDF-2

Size Price Availability Quantity
5ug USD 140  USD140 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
  • Purity: >98%, Endotoxin < 0.01 EU/µg
  • COA
  • MSDS
Biological Activity

Bone Morphogenetic Protein-9 (BMP-9), also known as Growth differentiation factor 2 (GDF2), is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-9/GDF-2 selectively signals through ACVRL1 in endothelial cells. Additionally, it engages in high-affinity interactions with ENG, forming a heterotetramer or a heteromeric complex with ENG and ACVRL1.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells, the ED50 for this effect is <0.4 ng/mL.

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGG
CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPI
SVLYKDDMGVPTLKYHYEGMSVAECGCR with polyhistidine tag at the N-terminus.


Accession: Q9UK05

Endotoxin < 0.01 EU/µg

Apparent Molecular Weight: ~16 KDa, reducing conditions

Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Chemical Information
Form Lyophilized powder
Solubility (25°C) Reconstitute the lyophilized powder in distilled water up to 100 μg/ml.
Storage Stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days and at -20°C for 3 months.
Related Cytokines and Growth Factors Products
Recombinant Human FGF-8b Protein (E. coli)

Recombinant Human FGF-8b Protein is a heparin-binding growth factor, which plays a core role in prenatal development, postnatal growth and regeneration of various tissues by promoting cell proliferation and other effect.

Recombinant Rat GDNF Protein (Baculovirus-Insect, N-His)

GDNF is an important member of the GDNF family of ligands. GDNF plays a key role in the promotion of the survival of dopaminergic neurons. GDNF is a highly conserved neurotrophic factor. The recombinant form of this protein also promotes the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. GDNF also regulates kidney development and spermatogenesis, and it affects alcohol consumption.

Recombinant Rat PDGF-BB (E. coli)

Platelet-Derived Growth Factor-BB (PDGF-BB) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. PDGF-BB functions in a paracrine manner and promotes organogenesis, human skeletal development, and wound healing. PDGF-BB also promotes angiogenesis, particularly in the presence of Fibroblast Growth Factor basic.

Recombinant Human ApoE3 Protein (HEK293, C-6His)

ApoE is a constituent of a subclass of high density of lipoproteins (HDL) involved in cholesterol transport. ApoE mediates high affinity binding of chylomicrons and vLDL particles to the LDL receptor, allowing for specific uptake of these particles by the liver, preventing the accumulation of cholesterol rich particles in the plasma.

Recombinant Mouse Granzyme B (HEK293, C-6His)

Granzyme B (GZMB) is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp and seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. The protein cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.

  Catalog
Abmole Inhibitor Catalog




Keywords: Recombinant Human BMP-9 Protein (E. coli, His Tag), Bone Morphogenetic Protein-9; GDF-2 supplier, Cytokines and Growth Factors, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.