| Cat.No. | Name | Information |
|---|---|---|
| M53566 | Abaecin | Abaecin is an antibacterial response peptide. |
| M53565 | AMPR-22 | AMPR-22 is an antimicrobial peptide. |
| M53564 | Arg-Trp | Arg-Trp is a dipeptide composed of arginine and tryptophan, and analogues of Arg-Trp-octyl ester show antibacterial activity. |
| M53563 | DFTamP1 | DFTamP1 is an antimicrobial peptide against Staphylococcus aureus USA300 activity (MIC is 3.1 μM). |
| M53562 | IN-2-LF | IN-2-LF is an inhibitor of lethal factor. |
| M53561 | KAMP-19 | KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. |
| M53560 | PMAP-36 | PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. |
| M53559 | Tet-213 | Tet-213 is a antimicrobial peptide. |
| M53558 | D-K6L9 | D-K6L9 shows antimicrobial and antibiofilm activities against P. |
| M53557 | EcAMP3 | EcAMP3 is a hairpin-like peptide. |
| M53556 | GLK-19 | GLK-19 is an antimicrobial peptide, and is active against E. |
| M53555 | L-K6L9 | L-K6L9 shows antimicrobial and antibiofilm activities against P. |
| M53554 | LS-BF1 | LS-BF1 is a stable and low toxic cationic antimicrobial peptide. |
| M53553 | Mram 8 | Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family. |
| M53551 | DJK-5 | Diplacol ia a natural compound from from Mimulus clevelandi and shows potent inhibitory activities against lipopolysaccharide (LPS)-induced nitric oxide production. |
| M53550 | CaLL | CaLL is an antimicrobial peptide. |
| M53548 | PGLa | PGLa, a 21-residue peptide, is an antimicrobial peptide. |
| M53547 | PP13 | PP13 is an antimicrobial peptide, and is active against Gram-negative and Gram-positive bacteria E.coli (MIC: 16.7 uM), B. |
| M53546 | RP-1 | RP-1 is an antimicrobial peptide, and is active against S. |
| M53545 | XT-1 | XT-1 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.
