| Cat.No. | Name | Information |
|---|---|---|
| M52805 | ω-Hexatoxin-Hv1a | ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels. |
| M52804 | ω-Grammotoxin SIA | ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. |
| M52803 | Ser-Ala-alloresact | Ser-Ala-alloresact is a sperm activating peptide (SAP). |
| M52802 | Huwentoxin XVI | Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. |
| M52801 | Imperatoxin A | Imperatoxin A is an activator of Ca2+-release channels/ryanodine receptors (RyRs) enhances the influx of Ca2+ from the sarcoplasmatic reticulum into the cell. |
| M52800 | Calcicludine | Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. |
| M52799 | Huwentoxin I | Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. |
| M52797 | Calciseptin | Calciseptine, a natural neurotoxin isolated from the black mamba Dendroaspis p. |
| M52796 | Verticilide | Verticilide is a ryanodine-binding inhibitor and inhibits ryanodine binding to ryanodine receptors in the cockroach at an IC50 value of 4.2 μM (whereas inhibition against mouse ryanodine receptors was weak (IC50=53.9 μM)). |
| M52795 | Myomodulin | Myomodulin is a neuropeptide present in molluscs, insects, and gastropods. |
| M52794 | Agelenin | Agelenin is a polypeptide composed of 35 amino acids. |
| M52793 | ProTx-I | ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. |
| M52792 | Calmodulin-Dependent Protein Kinase II (281-309) | Calmodulin-Dependent Protein Kinase II (281-309) is a peptide of calcium/calmodulin-dependent protein kinase II (CaM-kinase II). |
| M52791 | Calmodulin Binding Peptide 1 | Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca2+ release . |
| M52790 | CALP2 | CALP2 is a calmodulin (CaM) antagonist ( (Kd of 7.9 µM)) with high affinity for binding to the CaM EF-hand/Ca2+-binding site. |
| M52788 | cis-α-(Carboxycyclopropyl)glycine | cis-α-(Carboxycyclopropyl)glycine (L-CCG III) is a potent, competitive glutamate uptake inhibitor. |
| M52787 | CGP7930 | CGP7930 (3-(3’,5’-Di-tert-butyl-4’-hydroxy) phenyl-2, 2-dimethylpropanol) is a positive metabotropic GABAB receptor allosteric modulator. |
| M52786 | NT 13 | NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. |
| M52785 | Tat-NR2Baa | Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive. |
| M52784 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2024 AbMole BioScience. All Rights Reserved.
