Free shipping on all orders over $ 500

Felbamate

Cat. No. M2253
Felbamate Structure
Synonym:

Felbatol

Size Price Availability Quantity
10mg USD 60  USD60 In stock
50mg USD 200  USD200 In stock
100mg USD 330  USD330 In stock
200mg USD 500  USD500 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
Biological Activity

Felbamate(Felbatol) is an anticonvulsant compound used in epilepsy research.

Customer Product Validations & Biological Datas
Source Epilepsy Behav (2017). Figure 4. Felbamate
Method Drug administration
Cell Lines Sprague–Dawley rats
Concentrations 3000 mg/rat
Incubation Time 5 d
Results In the absence of prior appetitive experience, a quite different pattern emerges, with the FBM-treated rats showing an acquisition deficit that persists throughout much of the training
Source Epilepsy Behav (2017). Figure 3. Felbamate
Method Drug administration
Cell Lines Sprague–Dawley rats
Concentrations 3000 mg/rat
Incubation Time 5 d
Results FBM-treated animals showed enhanced acquisition in the aversive context with prior appetitive training relative to controls
Protocol (for reference only)
Cell Experiment
Cell lines Follicle cells
Preparation method Drug solutions were diluted into recording MBS from frozen stocks (NMDA, glycine) or dissolved from powder directly into MBS (felbamate, haloperidol) on the day of the experiment. Felbamate was dissolved in MBS to the highest concentration used (up to 3 mM) by heating to 50°C followed by vigorous stirring. The process was repeated once or twice, as necessary, until the felbamate dissolved.
Concentrations 1~3 mM
Incubation time 24 h
Animal Experiment
Animal models
Formulation
Dosages
Administration
Chemical Information
Molecular Weight 238.24
Formula C11H14N2O4
CAS Number 25451-15-4
Solubility (25°C) DMSO 40 mg/mL
Storage Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Conversion of different model animals based on BSA (PMID: 27057123)
Species Mouse Rat Rabbit Guinea pig Hamster Dog
Weight (kg) 0.02 0.15 1.8 0.4 0.08 10
Body Surface Area (m2) 0.007 0.025 0.15 0.05 0.02 0.5
Km factor 3 6 12 8 5 20
Animal A (mg/kg) = Animal B (mg/kg) multiplied by  Animal B Km
Animal A Km

For example, to modify the dose of Compound A used for a mouse (20 mg/kg) to a dose based on the BSA for a rat, multiply 20 mg/kg by the Km factor for a mouse and then divide by the Km factor for a rat. This calculation results in a rat equivalent dose for Compound A of 10 mg/kg.

References

[1] Shi LL, et al. Cochrane Database Syst Rev. Felbamate as an add-on therapy for refractory epilepsy.

[2] Kleckner NW, et al. J Pharmacol Exp Ther. Subtype-selective antagonism of N-methyl-D-aspartate receptors by felbamate: insights into the mechanism of action.

Related GluR Products
PDZ1 Domain inhibitor peptide

PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95).

CALP1

CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca2+-binding site.

NT 13

NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide.

Tat-NR2Baa

Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.

  Catalog
Abmole Inhibitor Catalog




Keywords: Felbamate, Felbatol supplier, GluR, inhibitors, activators


Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2023 AbMole BioScience. All Rights Reserved.