TCN-201 is a selective GluN2A-containing N-methyl-D-aspartate receptor (NMDAR) antagonist with IC50 of 0.326 μM. TCN-201 displays selectivity for GluN1/GluN2A NMDARs over GluN1/GluN2B containing NMDARs, in assays using two-electrode voltage-clamp (TEVC) recordings of NMDAR currents from Xenopus laevis oocytes expressing either GluN1/GluN2A or GluN1/GluN2B NMDARs. Similar to TCN 213, the degree of inhibition produced by TCN-201 is dependent on the concentration of the GluN1-site co-agonist, glycine (or D-serine), and is independent of the glutamate concentration. In regard to glycine at 3 μM, 10 μM, and 30 μM, the IC50 values of TCN-201 are 0.446 μM, 0.746 μM, and 3.89 μM, respectively, while with D-serine at 3 μM, 10 μM, and 30 μM, the IC50 values of TCN-201 are 0.326 μM, 0.816 μM, and 1.92 μM, respectively. TCN-201 acts in a non-competitive manner but its equilibrium constant at GluN1/GluN2A NMDARs indicates TCN-201 is around 30-times more potent than TCN 213. TCN-201 shows only modest antagonism of NMDAR-mediated currents recorded from young (DIV 9-10) neurones, but gives a strong block in older cultures (DIV 15-18) or in cultures where GluN2A subunits have been over-expressed. TCN-201 antagonism of NMDAR-mediated currents shows a negative correlation with their ifenprodil sensitivity and therefore, in combination with ifenprodil, can be used to monitor, pharmacologically, the expression levels of GluN2A and GluN2B NMDAR subunits in neuronal populations.
| Molecular Weight | 461.89 |
| Formula | C21H17ClFN3O4S |
| CAS Number | 852918-02-6 |
| Solubility (25°C) | DMSO ≥ 150 mg/mL |
| Storage | 4°C, protect from light, dry, sealed |
| Species | Mouse | Rat | Rabbit | Guinea pig | Hamster | Dog |
| Weight (kg) | 0.02 | 0.15 | 1.8 | 0.4 | 0.08 | 10 |
| Body Surface Area (m2) | 0.007 | 0.025 | 0.15 | 0.05 | 0.02 | 0.5 |
| Km factor | 3 | 6 | 12 | 8 | 5 | 20 |
| Animal A (mg/kg) = Animal B (mg/kg) multiplied by | Animal B Km |
| Animal A Km |
For example, to modify the dose of Compound A used for a mouse (20 mg/kg) to a dose based on the BSA for a rat, multiply 20 mg/kg by the Km factor for a mouse and then divide by the Km factor for a rat. This calculation results in a rat equivalent dose for Compound A of 10 mg/kg.
| Related GluR Products |
|---|
| PDZ1 Domain inhibitor peptide
PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95). |
| CALP1
CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca2+-binding site. |
| NT 13
NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. |
| Tat-NR2Baa
Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive. |
| VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2023 AbMole BioScience. All Rights Reserved.
