Free shipping on all orders over $ 500

MPEP hydrochloride

Cat. No. M2867
MPEP hydrochloride Structure
Synonym:

MPEP HCl

Size Price Availability Quantity
10mg USD 85  USD85 In stock
50mg USD 330  USD330 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
Biological Activity

MPEP hydrochloride is a selective antagonist for the metabotropic glutamate receptor subtype 5 (mGluR5) with IC50 of 36 nM. MPEP is a significantly more potent antagonist derived by structural derivatization around SIB-1757 and SIB-1893. MPEP has no agonist or antagonist activities at the human mGlu1b receptor expressed in CHO-K1 cells at concentrations up to 30 μM. When tested at group II and III receptors, MPEP does not show agonist or antagonist activity at 100 μM on human mGlu2, -3, -4a, -7b, and -8a receptors nor at 10 μM on the human mGlu6 receptor. MPEP has no significant effect at 100 μM on human NMDA (NMDA1A/2A), rat AMPA (Glu3-(flop)) and human kainate (Glu6-(IYQ)) receptor subtypes nor at 10 μM on the human NMDA1A/2B receptor. In rat neonatal brain slices, MPEP inhibits DHPG-stimulated PI hydrolysis with a potency and selectivity similar to that observed on human mGlu receptors. MPEP is centrally active following peripheral application and selectively inhibits group I agonist effects in the rat hippocampal CA1 area in vivo. MPEP produces anxiolytic-like effects in several tests such as the Vogel test in rats, the elevated plus-maze test in rats as well as the four-plate test in mice. MPEP also exerts antidepressant-like effects in the tail suspension test in mice. MPEP does not induce sedation nor disturb motor coordination in animals. [2] MPEP also acts as a positive allosteric modulator for the human metabotropic glutamate receptor 4 (hmGluR4). Blocking of mGluR5 with MPEP is able to rescue two major Fragile X Syndrome mouse model phenotypes. ?

Chemical Information
Molecular Weight 229.7
Formula C14H12ClN
CAS Number 219911-35-0
Solubility (25°C) Water ≥ 25 mg/mL
Storage Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Conversion of different model animals based on BSA (PMID: 27057123)
Species Mouse Rat Rabbit Guinea pig Hamster Dog
Weight (kg) 0.02 0.15 1.8 0.4 0.08 10
Body Surface Area (m2) 0.007 0.025 0.15 0.05 0.02 0.5
Km factor 3 6 12 8 5 20
Animal A (mg/kg) = Animal B (mg/kg) multiplied by  Animal B Km
Animal A Km

For example, to modify the dose of Compound A used for a mouse (20 mg/kg) to a dose based on the BSA for a rat, multiply 20 mg/kg by the Km factor for a mouse and then divide by the Km factor for a rat. This calculation results in a rat equivalent dose for Compound A of 10 mg/kg.

References

[1] Francesca Manag, et al. Interaction between the mGlu receptors 5 antagonist, MPEP, and amphetamine on memory and motor functions in mice

[2] Jos Luis Albasanz, et al. 2-Methyl-6-(phenylethynyl)pyridine Hydrochloride Modulates Metabotropic Glutamate 5 Receptors Endogenously Expressed in Zebrafish Brain

[3] Maija L Castrn, et al. BDNF in fragile X syndrome

Related GluR Products
PDZ1 Domain inhibitor peptide

PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95).

CALP1

CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca2+-binding site.

NT 13

NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide.

Tat-NR2Baa

Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.

  Catalog
Abmole Inhibitor Catalog




Keywords: MPEP hydrochloride, MPEP HCl supplier, GluR, inhibitors, activators


Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2023 AbMole BioScience. All Rights Reserved.