Free shipping on all orders over $ 500

Cycloleucine

Cat. No. M10378
Cycloleucine Structure
Synonym:

1-Aminocyclopentanecarboxylic acid

Size Price Availability Quantity
100mg USD 50  USD50 In stock
500mg USD 100  USD100 In stock
1g USD 135  USD135 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
Biological Activity

Cycloleucine is antagonist of NMDA receptor associated glycine receptor, with a Ki of 600 μM. Cycloleucine is a specific inhibitor of S-adenosyl-methionine mediated methylation. Cycloleucine is also a competitive inhibitor of ATP: L-methionine-S-adenosyl transferase in vitro. Cycloleucine (4-40 mM) 3 hours blocks internal methylation of viral RNA in B77 transformed chick embryo fibroblasts. 

In vivo, Cycloleucine (0.5-4 µg; intracerebroventrical injection) increases time spent in open arms, open arm entries, and extreme arrivals in rats. Cycloleucine reduces thymus and spleen weights in Semliki Forest virus (SFV) strain A7(74) infected and control mice.

Chemical Information
Molecular Weight 129.16
Formula C6H11NO2
CAS Number 52-52-8
Solubility (25°C) Water 50 mg/mL
Storage -20°C, protect from light, sealed
Conversion of different model animals based on BSA (PMID: 27057123)
Species Mouse Rat Rabbit Guinea pig Hamster Dog
Weight (kg) 0.02 0.15 1.8 0.4 0.08 10
Body Surface Area (m2) 0.007 0.025 0.15 0.05 0.02 0.5
Km factor 3 6 12 8 5 20
Animal A (mg/kg) = Animal B (mg/kg) multiplied by  Animal B Km
Animal A Km

For example, to modify the dose of Compound A used for a mouse (20 mg/kg) to a dose based on the BSA for a rat, multiply 20 mg/kg by the Km factor for a mouse and then divide by the Km factor for a rat. This calculation results in a rat equivalent dose for Compound A of 10 mg/kg.

References

[1] Augusto P I Gargiulo, et al. Neuropsychobiology. Effects of Cycloleucine in the Nucleus Accumbens Septi on the Elevated plus Maze Test in Rats

[2] S Amor, et al. Br J Exp Pathol. The effect of cycloleucine on SFV A7(74) infection in mice

[3] W F Hood, et al. Eur J Pharmacol. 1-Aminocyclobutane-1-carboxylate (ACBC): a specific antagonist of the N-methyl-D-aspartate receptor coupled glycine receptor

[4] K Dimock, et al. Biochemistry. Cycloleucine blocks 5'-terminal and internal methylations of avian sarcoma virus genome RNA

Related GluR Products
PDZ1 Domain inhibitor peptide

PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95).

CALP1

CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca2+-binding site.

NT 13

NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide.

Tat-NR2Baa

Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.

  Catalog
Abmole Inhibitor Catalog




Keywords: Cycloleucine, 1-Aminocyclopentanecarboxylic acid supplier, GluR, inhibitors, activators


Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2023 AbMole BioScience. All Rights Reserved.